PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 59082
Common NameSELMODRAFT_59081, SELMODRAFT_59082
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family SRS
Protein Properties Length: 118aa    MW: 12859.7 Da    PI: 8.5913
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
59082genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702102.76.4e-32154861
  DUF702  8 CqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaass 61
            C++CGnqakkdC+++RCRtCCksrgf+C+thv+stWvpaakrrerq ++aaa +
   59082  1 CKECGNQAKKDCVYQRCRTCCKSRGFECSTHVRSTWVPAAKRRERQLAEAAAVA 54
            *********************************************988887654 PP

2DUF70268.81.7e-2165118100152
  DUF702 100 letsslPeevsseavfrcvrvssvdd.geeelaYqtavsigGhvfkGiLydqGl 152
             +++ slP+ev+++avf+cv+v+sv+d ge+e+aYq++v igG +fkG+L+d+G+
   59082  65 TDAGSLPSEVRAQAVFKCVKVTSVEDgGEDEFAYQAVVRIGGRIFKGVLQDHGV 118
             56778*********************899***********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051424.1E-28154IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.6E-27142IPR006510Zinc finger, lateral root primordium type 1
PfamPF051426.6E-1967118IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016249.4E-2470118IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
CKECGNQAKK DCVYQRCRTC CKSRGFECST HVRSTWVPAA KRRERQLAEA AAVASGQPPL  60
HLFATDAGSL PSEVRAQAVF KCVKVTSVED GGEDEFAYQA VVRIGGRIFK GVLQDHGV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002972059.11e-82hypothetical protein SELMODRAFT_59082, partial
RefseqXP_002972605.11e-82hypothetical protein SELMODRAFT_59081, partial
SwissprotQ9SD407e-44SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLD8RLS71e-82D8RLS7_SELML; Putative uncharacterized protein (Fragment)
STRINGEFJ266913e-82(Selaginella moellendorffii)
STRINGEFJ269763e-82(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13131549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.14e-45Lateral root primordium (LRP) protein-related
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]